Biochemical and Biophysical Research Communications
trans-Dienelactone hydrolase from Pseudomonas reinekei MT1, a novel zinc-dependent hydrolase
Section snippets
Materials and methods
Bacterial strain and gene identification. Pseudomonas reinekei MT1 was grown and cell extracts prepared as previously described [12]. The gene fragment encoding the N-terminal protein sequence of trans-DLH was amplified by touchdown PCR (annealing temperatures of 60–50 °C) using primers YTNCCNACNTAYAAGCA and CCNGGNGGNGCRTCTTT, which were designed based on the previously determined N-terminal protein sequence (underlined) TDTSKSLPTYKQLLERKDAPPGSSWGLFGK [12]. A single 47 bp fragment was obtained,
Identification of the trans-DLH gene
The gene encoding trans-DLH involved in the degradation of 4- and 5-chlorosalicylate by P. reinekei MT1 was identified. The deduced N-terminus (TDTSKSLPTYKQLLERKDAPPGSSWGLFGK) of the identified gene was identical to the N-terminus previously described [12]. The gene comprises 1011 bp and encodes a protein of 336 amino acids, with a calculated molecular mass of 36.935 kDa. The deduced protein did not show similarity with any protein of assigned function described in public databases. Similarity
Discussion
A novel type of hydrolase, which is involved in the degradation of chlorosalicylates [12] has been characterized from P. reinekei MT1. PSI-BLAST searches using default parameters starting with the trans-DLH protein converged to about 300 proteins, many of which were annotated as putative cyclases or putative metal dependent hydrolases (see Supplementary Material). Conserved Domain Database [19] searches suggested that these proteins form a family that is classified as COG1878 in the Clusters of
Acknowledgments
This work was supported by the DFG-European Graduate College 653. We thank Iris Plumeier for excellent technical support. We are indebted to Dieter Zachmann from TU-Braunschweig and Manuel Ferrer from CSIC (Madrid) for their precious collaboration in the ICP-MS analysis and to Melissa Wos for critical reading of the manuscript.
References (31)
- et al.
The conversion of catechol and protocatechuate to beta-ketoadipate by Pseudomonas putida. 1. Biochemistry
J. Biol. Chem.
(1966) A rapid and sensitive method for the quantitation of protein utilizing the principle of protein-dye binding
Anal. Biochem.
(1976)- et al.
Modulation of Streptomyces leucine aminopeptidase by calcium: identification and functional analysis of key residues in activation and stabilization by calcium
J. Biol. Chem.
(2006) - et al.
EXAFS studies of the zinc sites of UDP-(3-O-acyl)-N-acetylglucosamine deacetylase (LpxC)
J. Inorg. Biochem.
(2003) - et al.
The beta-ketoadipate pathway and the biology of self-identity
Annu. Rev. Microbiol.
(1996) - et al.
Degradation of chloroaromatics by Pseudomona(d)s
Evolution of chlorocatechol catabolic pathways
Biodegradation
(1994)- et al.
Substrate-induced activation of dienelactone hydrolase: an enzyme with a naturally occurring Cys-His-Asp triad
Protein Eng.
(1993) - et al.
Chemical structure and biodegradability of halogenated aromatic compounds. Conversion of chlorinated muconic acids into maleoylacetic acid
Biochem. J.
(1980) - et al.
Different types of dienelactone hydrolase in 4-fluorobenzoate-utilizing bacteria
J. Bacteriol.
(1990)